Recombinant Full Length Human DCD Protein, C-Flag-tagged

• Cat.No.: DCD-650HFL
• Product Overview: Recombinant Full Length Human DCD Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: This antimicrobial gene encodes a secreted protein that is subsequently processed into mature peptides of distinct biological activities. The C-terminal peptide is constitutively expressed in sweat and has antibacterial and antifungal activities. The N-terminal peptide, also known as diffusible survival evasion peptide, promotes neural cell survival under conditions of severe oxidative stress. A glycosylated form of the N-terminal peptide may be associated with cachexia (muscle wasting) in cancer patients. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 9.2 kDa
• AA Sequence: MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGL
  DGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Secreted Protein
• Full Length: Full L.

Gene Information

• Gene Name: DCD dermcidin [ Homo sapiens (human) ]
• Official Symbol: DCD
• Synonyms: PIF; AIDD; DSEP; HCAP; DCD-1
• Gene ID: 117159
• mRNA Refseq: NM_053283.4
• Protein Refseq: NP_444513.1
• MIM: 606634
• UniProt ID: P81605