Recombinant Human DCD Protein, GST-tagged

• Cat.No.: DCD-2388H
• Product Overview: Human DCD full-length ORF (AAH62682.1, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This antimicrobial gene encodes a secreted protein that is subsequently processed into mature peptides of distinct biological activities. The C-terminal peptide is constitutively expressed in sweat and has antibacterial and antifungal activities. The N-terminal peptide, also known as diffusible survival evasion peptide, promotes neural cell survival under conditions of severe oxidative stress. A glycosylated form of the N-terminal peptide may be associated with cachexia (muscle wasting) in cancer patients. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014]
• Molecular Mass: 38.5 kDa
• AA Sequence: MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DCD dermcidin [ Homo sapiens ]
• Official Symbol: DCD
• Synonyms: DCD; dermcidin; AIDD; DCD 1; diffusible survival/evasion peptide; DSEP; HCAP; PIF; preproteolysin; proteolysis inducing factor; survival promoting peptide; DCD-1; MGC71930
• Gene ID: 117159
• mRNA Refseq: NM_053283
• Protein Refseq: NP_444513
• MIM: 606634
• UniProt ID: P81605