Recombinant Human DCAF7 protein, His-SUMO-tagged

• Cat.No.: DCAF7-3761H
• Product Overview: Recombinant Human DCAF7 protein(P61962)(1-342aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-342aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 54.9 kDa
• AA Sequence: MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: DCAF7 DDB1 and CUL4 associated factor 7 [ Homo sapiens ]
• Official Symbol: DCAF7
• Synonyms: DCAF7; DDB1 and CUL4 associated factor 7; WD repeat domain 68 , WDR68; DDB1- and CUL4-associated factor 7; HAN11; human anthocyanin; seven WD repeat protein of the AN11 family 1; SWAN 1; WD-repeat protein; WD repeat domain 68; WD repeat-containing protein 68; WD repeat-containing protein An11 homolog; seven-WD-repeat protein of the AN11 family-1; AN11; WDR68; SWAN-1
• Gene ID: 10238
• mRNA Refseq: NM_005828
• Protein Refseq: NP_005819
• MIM: 605973
• UniProt ID: P61962