Recombinant Full Length Human DCAF7 Protein, GST-tagged

• Cat.No.: DCAF7-3456HF
• Product Overview: Human HAN11 full-length ORF ( AAH01264, 1 a.a. - 342 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 342 amino acids
• Description: This gene encodes a protein with multiple WD40 repeats which facilitate protein-protein interactions and thereby enable the assembly of multiprotein complexes. This protein has been shown to function as a scaffold protein for protein complexes involved in kinase signaling. This highly conserved gene is present in eukaryotic plants, fungi, and animals. The ortholog of this gene was first identified in plants as a key regulator of anthocyanin biosynthesis and flower pigmentation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]
• Molecular Mass: 63.14 kDa
• AA Sequence: MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DCAF7 DDB1 and CUL4 associated factor 7 [ Homo sapiens (human) ]
• Official Symbol: DCAF7
• Synonyms: DCAF7; DDB1 and CUL4 associated factor 7; AN11; HAN11; WDR68; SWAN-1; DDB1- and CUL4-associated factor 7; WD repeat-containing protein 68; WD repeat-containing protein An11 homolog; human anthocyanin; seven-WD-repeat protein of the AN11 family-1
• Gene ID: 10238
• mRNA Refseq: NM_005828
• Protein Refseq: NP_005819
• MIM: 605973
• UniProt ID: P61962