Recombinant Human DCAF7, His-tagged

• Cat.No.: DCAF7-30698TH
• Product Overview: Recombinant fragment of Human WDR68 with an N terminal His tag; 298aa, 33.6kDa inclusive of tag.

Specification

• Description: The WD-repeat protein is encoded by the DCAF7 protein, it is 53% identical to the petunia An11 protein and is conserved in worms and yeast, which do not produce anthocyanins.
• Protein length: 277 amino acids
• Conjugation: HIS
• Molecular Weight: 33.600kDa
• Source: E. coli
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 2.4% Urea
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWD
• Sequence Similarities: Belongs to the WD repeat DCAF7 family.Contains 4 WD repeats.

Gene Information

• Gene Name: DCAF7 DDB1 and CUL4 associated factor 7 [ Homo sapiens ]
• Official Symbol: DCAF7
• Synonyms: DCAF7; DDB1 and CUL4 associated factor 7; WD repeat domain 68 , WDR68; DDB1- and CUL4-associated factor 7; HAN11; human anthocyanin; seven WD repeat protein of the AN11 family 1; SWAN 1
• Gene ID: 10238
• mRNA Refseq: NM_005828
• Protein Refseq: NP_005819
• MIM: 605973
• Uniprot ID: P61962
• Chromosome Location: 17q23.3
• Pathway: TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem
• Function: protein binding