Recombinant Human DCAF6 protein, His-tagged

Cat.No. : DCAF6-5763H
Product Overview : Recombinant Human DCAF6 protein(1-232 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-232 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : RERDGEQSPNVSLMQRMSDMLSRWFEEASEVAQSNRGRGRSRPRGGTSQSDISTLPTVPSSPDLEVSETAMEVDTPAEQFLQPSTSSTMSAQAHSTSSPTESPHSTPLLSSPDSEQRQSVEASGHHTHHQSDNNNEKLSPKPGTGEPVLSLHYSTEGTTTSTIKLNFTDEWSSIASSSRGIGSHCKSEGQEESFVPQSSVQPPEGDSETKAPEESSEDATKYQEGVSAENPV
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol DCAF6
Synonyms DCAF6; DDB1 and CUL4 associated factor 6; IQ motif and WD repeats 1 , IQWD1; DDB1- and CUL4-associated factor 6; PC326
Gene ID 55827
mRNA Refseq NM_018442
Protein Refseq NP_060912
MIM 610494
UniProt ID Q58WW2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DCAF6 Products

Required fields are marked with *

My Review for All DCAF6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon