Recombinant Human DCAF6, His-tagged
Cat.No. : | DCAF6-27575TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 536-860 of Human NRIP with N terminal His tag; 325 amino acids, 74kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 536-860 a.a. |
Description : | WD-repeat proteins are a large family of eukaryotic proteins coordinating multi-protein complex assemblies. Their role has been implicated in multiple cellular processes including signal transduction, transcriptional regulation, cell cycle control and apoptosis. NRIP is a novel 860a.a nuclear protein consisting of seven conserved WD40 domains and one NLS motif. It binds to androgen and glucocorticoid receptors and up-regulates their transcriptional activity, thereby functioning as a nuclear receptor co-activator. Role of NRIP has been implicated in cell growth and also in cervical and prostrate cancer, thus indicating a potential therapeutic intervention. Northern Blot analysis detects a high expression of NRIP in skeletal muscle and testis and low expression in heart, prostrate and adrenal gland. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 68 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ETKAPEESSEDVTKYQEGVSAENPVENHINITQSDKFTAK PLDSNSGERNDLNLDRSCGVPEESASSEKAKEPETSDQ TSTESATNENNTNPEPQFQTEATGPSAHEETSTRDSAL QDTDDSDDDPVLIPGARYRAGPGDRRSAVARIQEFFRRRK ERKEMEELDTLNIRRPLVKMVYKGHRNSRTMIKEANFW GANFVMSGSDCGHIFIWDRHTAEHLMLLEADNHVVNCL QPHPFDPILASSGIDYDIKIWSPLEESRIFNRKLADEVIT RNELMLEETRNTITVPASFMLRMLASLNHIRADRLEGD RSEGSGQENENEDEE |
Gene Name | DCAF6 DDB1 and CUL4 associated factor 6 [ Homo sapiens ] |
Official Symbol | DCAF6 |
Synonyms | DCAF6; DDB1 and CUL4 associated factor 6; IQ motif and WD repeats 1 , IQWD1; DDB1- and CUL4-associated factor 6; PC326; |
Gene ID | 55827 |
mRNA Refseq | NM_018442 |
Protein Refseq | NP_060912 |
MIM | 610494 |
Uniprot ID | Q58WW2 |
Chromosome Location | 1q23.3 |
Function | ligand-dependent nuclear receptor transcription coactivator activity; |
◆ Recombinant Proteins | ||
DCAF6-5763H | Recombinant Human DCAF6 protein, His-tagged | +Inquiry |
DCAF6-2222M | Recombinant Mouse DCAF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
DCAF6-27575TH | Recombinant Human DCAF6, His-tagged | +Inquiry |
DCAF6-5057H | Recombinant Human DCAF6 Protein, GST-tagged | +Inquiry |
DCAF6-4338M | Recombinant Mouse DCAF6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCAF6-870HCL | Recombinant Human DCAF6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCAF6 Products
Required fields are marked with *
My Review for All DCAF6 Products
Required fields are marked with *
0
Inquiry Basket