Recombinant Human DBF4B Protein, GST-tagged

• Cat.No.: DBF4B-2657H
• Product Overview: Human DRF1 full-length ORF ( NP_079380.1, 1 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a regulator of the cell division cycle 7 homolog (S. cerevisiae) protein, a serine-threonine kinase which links cell cycle regulation to genome duplication. This protein localizes to the nucleus and, in complex with the cell division cycle 7 homolog (S. cerevisiae) protein, may facilitate M phase progression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2010]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 44.8 kDa
• AA Sequence: MSEPGKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSGKSFYLDLPAGKNLQFLTGAIQQLGGVIEGFLSKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPSRKPVDSVPLSRGKELLQKAIRNQVSWGKMGQSRWSPA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DBF4B DBF4 homolog B (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: DBF4B
• Synonyms: DBF4B; DBF4 homolog B (S. cerevisiae); protein DBF4 homolog B; ASKL1; chifb; chiffon homolog B (Drosophila); DRF1; FLJ13087; ZDBF1B; zinc finger; DBF type containing 1B; chiffon homolog B; ASK-like protein 1; Dbf4-related factor 1; zinc finger, DBF-type containing 1B; activator of S-phase kinase-like protein 1; CHIFB; MGC15009
• Gene ID: 80174
• mRNA Refseq: NM_025104
• Protein Refseq: NP_079380
• MIM: 611661
• UniProt ID: Q8NFT6