Recombinant Human DAP
| Cat.No. : | DAP-27364TH |
| Product Overview : | Recombinant full length Human DAP1 with a N terminal proprietary tag: predicted molecular weight 36.96 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma. |
| Protein length : | 102 amino acids |
| Molecular Weight : | 36.960kDa inclusive of tags |
| Source : | Wheat germ |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEK DKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQ KPHASMDKHPSPRTQHIQQPRK |
| Tag : | Non |
| Gene Name | DAP death-associated protein [ Homo sapiens ] |
| Official Symbol | DAP |
| Synonyms | DAP; death-associated protein; death-associated protein 1; |
| Gene ID | 1611 |
| mRNA Refseq | NM_004394 |
| Protein Refseq | NP_004385 |
| MIM | 600954 |
| Uniprot ID | P51397 |
| Chromosome Location | 5p15.2 |
| Pathway | TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; |
| Function | death domain binding; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DAP Products
Required fields are marked with *
My Review for All DAP Products
Required fields are marked with *
0
Inquiry Basket
