Recombinant Human DAP Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DAP-5863H
• Product Overview: DAP MS Standard C13 and N15-labeled recombinant protein (NP_004385) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Molecular Mass: 11.2 kDa
• AA Sequence: MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DAP death-associated protein [ Homo sapiens (human) ]
• Official Symbol: DAP
• Synonyms: DAP; death-associated protein; death-associated protein 1; DAP-1; MGC99796
• Gene ID: 1611
• mRNA Refseq: NM_004394
• Protein Refseq: NP_004385
• MIM: 600954
• UniProt ID: P51397