Recombinant Human DAOA Protein (1-153 aa), GST-tagged

• Cat.No.: DAOA-448H
• Product Overview: Recombinant Human DAOA Protein (1-153 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Apoptosis. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-153 aa
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 45.1 kDa
• AA Sequence: MLEKLMGADSLQLFRSRYTLGKIYFIGFQRSILLSKSENSLNSIAKETEEGRETVTRKEGWKRRHEDGYLEMAQRHLQRSLCPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYNQQKDQSCNHKEITSTKAE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: DAOA D-amino acid oxidase activator [ Homo sapiens (human) ]
• Official Symbol: DAOA
• Synonyms: LG72; SG72
• Gene ID: 267012
• UniProt ID: P59103