Recombinant Human DAG1 Protein, GST-tagged

• Cat.No.: DAG1-2327H
• Product Overview: Human DAG1 partial ORF ( AAH12740, 31 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes dystroglycan, a central component of dystrophin-glycoprotein complex that links the extracellular matrix and the cytoskeleton in the skeletal muscle. The encoded preproprotein undergoes O- and N-glycosylation, and proteolytic processing to generate alpha and beta subunits. Certain mutations in this gene are known to cause distinct forms of muscular dystrophy. Alternative splicing results in multiple transcript variants, all encoding the same protein. [provided by RefSeq, Nov 2015]
• Molecular Mass: 37.84 kDa
• AA Sequence: WPSEPSEAVRDWENQLEASMHSVLSDLHEAVPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGLPLDTDKGVHYISVSATRLGA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DAG1 dystroglycan 1 (dystrophin-associated glycoprotein 1) [ Homo sapiens ]
• Official Symbol: DAG1
• Synonyms: DAG1; dystroglycan 1 (dystrophin-associated glycoprotein 1); dystroglycan; 156DAG; A3a; AGRNR; alpha dystroglycan; beta dystroglycan; DAG; dystrophin associated glycoprotein 1; MDDGC7; FLJ51254
• Gene ID: 1605
• mRNA Refseq: NM_001165928
• Protein Refseq: NP_001159400
• MIM: 128239
• UniProt ID: Q14118