Recombinant Human DAG1 Protein, GST-tagged
Cat.No. : | DAG1-2327H |
Product Overview : | Human DAG1 partial ORF ( AAH12740, 31 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes dystroglycan, a central component of dystrophin-glycoprotein complex that links the extracellular matrix and the cytoskeleton in the skeletal muscle. The encoded preproprotein undergoes O- and N-glycosylation, and proteolytic processing to generate alpha and beta subunits. Certain mutations in this gene are known to cause distinct forms of muscular dystrophy. Alternative splicing results in multiple transcript variants, all encoding the same protein. [provided by RefSeq, Nov 2015] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | WPSEPSEAVRDWENQLEASMHSVLSDLHEAVPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGLPLDTDKGVHYISVSATRLGA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DAG1 dystroglycan 1 (dystrophin-associated glycoprotein 1) [ Homo sapiens ] |
Official Symbol | DAG1 |
Synonyms | DAG1; dystroglycan 1 (dystrophin-associated glycoprotein 1); dystroglycan; 156DAG; A3a; AGRNR; alpha dystroglycan; beta dystroglycan; DAG; dystrophin associated glycoprotein 1; MDDGC7; FLJ51254; |
Gene ID | 1605 |
mRNA Refseq | NM_001165928 |
Protein Refseq | NP_001159400 |
MIM | 128239 |
UniProt ID | Q14118 |
◆ Recombinant Proteins | ||
DAG1-3701C | Recombinant Chicken DAG1 | +Inquiry |
Dag1-689M | Recombinant Mouse Dag1 Protein, His-tagged | +Inquiry |
DAG1-200H | Recombinant Human DAG1 | +Inquiry |
DAG1-26240TH | Recombinant Human DAG1 | +Inquiry |
DAG1-1174R | Recombinant Rhesus monkey DAG1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DAG1-7082HCL | Recombinant Human DAG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DAG1 Products
Required fields are marked with *
My Review for All DAG1 Products
Required fields are marked with *
0
Inquiry Basket