Recombinant Human CYTH2 Protein, GST-tagged

Cat.No. : CYTH2-2303H
Product Overview : Human CYTH2 full-length ORF ( NP_059431.1, 1 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The encoded protein exhibits GEP activity in vitro with ARF1, ARF3, and ARF6 and is 83% homologous to CYTH1. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
Molecular Mass : 72.9 kDa
AA Sequence : MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CYTH2 cytohesin 2 [ Homo sapiens ]
Official Symbol CYTH2
Synonyms CYTH2; cytohesin 2; pleckstrin homology, Sec7 and coiled coil domains 2 , pleckstrin homology, Sec7 and coiled/coil domains 2 (cytohesin 2) , PSCD2, PSCD2L; cytohesin-2; ARNO; CTS18.1; Sec7p L; Sec7p like; ARF exchange factor; ARF nucleotide-binding site opener; PH, SEC7 and coiled-coil domain-containing protein 2; pleckstrin homology, Sec7 and coiled-coil domains 2 (cytohesin-2); pleckstrin homology, Sec7 and coiled/coil domains 2 (cytohesin-2); CTS18; PSCD2; SEC7L; PSCD2L; Sec7p-L; Sec7p-like;
Gene ID 9266
mRNA Refseq NM_004228
Protein Refseq NP_004219
MIM 602488
UniProt ID Q99418

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CYTH2 Products

Required fields are marked with *

My Review for All CYTH2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon