Recombinant Full Length Human CYTH2 Protein, GST-tagged

• Cat.No.: CYTH2-2500HF
• Product Overview: Human CYTH2 full-length ORF ( NP_059431.1, 1 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 400 amino acids
• Description: The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The encoded protein exhibits GEP activity in vitro with ARF1, ARF3, and ARF6 and is 83% homologous to CYTH1. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
• Molecular Mass: 72.9 kDa
• AA Sequence: MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CYTH2 cytohesin 2 [ Homo sapiens ]
• Official Symbol: CYTH2
• Synonyms: CYTH2; cytohesin 2; pleckstrin homology, Sec7 and coiled coil domains 2 , pleckstrin homology, Sec7 and coiled/coil domains 2 (cytohesin 2) , PSCD2, PSCD2L; cytohesin-2; ARNO; CTS18.1; Sec7p L; Sec7p like; ARF exchange factor; ARF nucleotide-binding site opener; PH, SEC7 and coiled-coil domain-containing protein 2; pleckstrin homology, Sec7 and coiled-coil domains 2 (cytohesin-2); pleckstrin homology, Sec7 and coiled/coil domains 2 (cytohesin-2); CTS18; PSCD2; SEC7L; PSCD2L; Sec7p-L; Sec7p-like
• Gene ID: 9266
• mRNA Refseq: NM_004228
• Protein Refseq: NP_004219
• MIM: 602488
• UniProt ID: Q99418