Recombinant Human CYP4F2 protein, GST-tagged

• Cat.No.: CYP4F2-301409H
• Product Overview: Recombinant Human CYP4F2 (251-324 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: Met251-Thr324
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADT
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: CYP4F2 cytochrome P450, family 4, subfamily F, polypeptide 2 [ Homo sapiens ]
• Official Symbol: CYP4F2
• Synonyms: CYP4F2; cytochrome P450, family 4, subfamily F, polypeptide 2; cytochrome P450, subfamily IVF, polypeptide 2; leukotriene-B(4) omega-hydroxylase 1; CYPIVF2; cytochrome P450 4F2; cytochrome P450-LTB-omega; leukotriene-B4 20-monooxygenase; leukotriene B4 omega-hydroxylase; leukotriene-B(4) 20-monooxygenase 1; CPF2
• Gene ID: 8529
• mRNA Refseq: NM_001082
• Protein Refseq: NP_001073
• MIM: 604426
• UniProt ID: P78329