Recombinant Human CYP4F2 protein, GST-tagged

Cat.No. : CYP4F2-301409H
Product Overview : Recombinant Human CYP4F2 (251-324 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met251-Thr324
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADT
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name CYP4F2 cytochrome P450, family 4, subfamily F, polypeptide 2 [ Homo sapiens ]
Official Symbol CYP4F2
Synonyms CYP4F2; cytochrome P450, family 4, subfamily F, polypeptide 2; cytochrome P450, subfamily IVF, polypeptide 2; leukotriene-B(4) omega-hydroxylase 1; CYPIVF2; cytochrome P450 4F2; cytochrome P450-LTB-omega; leukotriene-B4 20-monooxygenase; leukotriene B4 omega-hydroxylase; leukotriene-B(4) 20-monooxygenase 1; CPF2;
Gene ID 8529
mRNA Refseq NM_001082
Protein Refseq NP_001073
MIM 604426
UniProt ID P78329

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CYP4F2 Products

Required fields are marked with *

My Review for All CYP4F2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon