Recombinant Human CYP3A43 protein, His&Myc-tagged

• Cat.No.: CYP3A43-4333H
• Product Overview: Recombinant Human CYP3A43 protein(Q9HB55)(1-393aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: N-His&C-Myc
• ProteinLength: 1-393aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 52.3 kDa
• AASequence: MDLIPNFAMETWVLVATSLVLLYIYGTHSHKLFKKLGIPGPTPLPFLGTILFYLRRSLNKIPSWAWWLTPVIPALWEAEAGGSPKVRSSRPALPTWVFGILTENVMKNTEKCGALFPFLTPVFEALNIGLFPKDVTHFLKNSIERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIIIFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAPVTYDALVQMEYLDMVVNETLRLFPVVSRVTRVCKKDIEINGVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPERFSKKNKDSIDLYRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFSFKPCKETQIPLKLDNLPILQPEKPIVLKVHLRDGITSGP
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CYP3A43 cytochrome P450, family 3, subfamily A, polypeptide 43 [ Homo sapiens ]
• Official Symbol: CYP3A43
• Synonyms: CYP3A43; cytochrome P450, family 3, subfamily A, polypeptide 43; cytochrome P450, subfamily IIIA, polypeptide 43; cytochrome P450 3A43; cytochrome P450 polypeptide 43; MGC119315; MGC119316
• Gene ID: 64816
• mRNA Refseq: NM_022820
• Protein Refseq: NP_073731
• MIM: 606534
• UniProt ID: Q9HB55