Recombinant Human CYP2C9 protein, His&Myc-tagged

• Cat.No.: CYP2C9-2795H
• Product Overview: Recombinant Human CYP2C9 protein(P11712)(1-162aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 25.4 kDa
• Protein length: 1-162aa
• AA Sequence: MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKGG
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CYP2C9 cytochrome P450, family 2, subfamily C, polypeptide 9 [ Homo sapiens ]
• Official Symbol: CYP2C9
• Synonyms: CYP2C9; cytochrome P450, family 2, subfamily C, polypeptide 9; CYP2C10, cytochrome P450, subfamily IIC (mephenytoin 4 hydroxylase), polypeptide 9; cytochrome P450 2C9; P450IIC9; cytochrome P-450MP; cytochrome P450 PB-1; microsomal monooxygenase; xenobiotic monooxygenase; flavoprotein-linked monooxygenase; cytochrome P-450 S-mephenytoin 4-hydroxylase; CPC9; CYP2C; CYP2C10; CYPIIC9; MGC88320; MGC149605
• Gene ID: 1559
• mRNA Refseq: NM_000771
• Protein Refseq: NP_000762
• MIM: 601130
• UniProt ID: P11712