Recombinant Human CYP2C9 protein, His&Myc-tagged
Cat.No. : | CYP2C9-2795H |
Product Overview : | Recombinant Human CYP2C9 protein(P11712)(1-162aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-162aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 25.4 kDa |
AA Sequence : | MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKGG |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CYP2C9 cytochrome P450, family 2, subfamily C, polypeptide 9 [ Homo sapiens ] |
Official Symbol | CYP2C9 |
Synonyms | CYP2C9; cytochrome P450, family 2, subfamily C, polypeptide 9; CYP2C10, cytochrome P450, subfamily IIC (mephenytoin 4 hydroxylase), polypeptide 9; cytochrome P450 2C9; P450IIC9; cytochrome P-450MP; cytochrome P450 PB-1; microsomal monooxygenase; xenobiotic monooxygenase; flavoprotein-linked monooxygenase; cytochrome P-450 S-mephenytoin 4-hydroxylase; CPC9; CYP2C; CYP2C10; CYPIIC9; MGC88320; MGC149605; |
Gene ID | 1559 |
mRNA Refseq | NM_000771 |
Protein Refseq | NP_000762 |
MIM | 601130 |
UniProt ID | P11712 |
◆ Recombinant Proteins | ||
CYP2C9-530H | Recombinant Human CYP2C9, GST-tagged | +Inquiry |
CYP2C9-1151R | Recombinant Rhesus monkey CYP2C9 Protein, His-tagged | +Inquiry |
CYP2C9-74H | Active Recombinant Human CYP2C9 Protein | +Inquiry |
CYP2C9-125C | Active Recombinant Cynomolgus CYP2C9 Protein | +Inquiry |
CYP2C9-531H | Recombinant Human CYP2C9 protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP2C9-7113HCL | Recombinant Human CYP2C9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP2C9 Products
Required fields are marked with *
My Review for All CYP2C9 Products
Required fields are marked with *
0
Inquiry Basket