Recombinant Human CYP2C9, GST-tagged

Cat.No. : CYP2C9-530H
Product Overview : Human CYP2C9 full-length ORF ( AAH20754.1, 1 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1 a.a. - 162 a.a.
Description : This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by rifampin. The enzyme is known to metabolize many xenobiotics, including phenytoin, tolbutamide, ibuprofen and S-warfarin. Studies identifying individuals who are poor metabolizers of phenytoin and tolbutamide suggest that this gene is polymorphic. The gene is located within a cluster of cytochrome P450 genes on chromosome 10q24.
Molecular Mass : 43.56 kDa
AA Sequence : MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIV VLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEAR CLVEELRKTKGG
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CYP2C9 cytochrome P450, family 2, subfamily C, polypeptide 9 [Homo sapiens (human) ]
Official Symbol CYP2C9
Synonyms CYP2C9; CPC9; CYP2C; CYP2C10; CYPIIC9; P450IIC9; cytochrome P450, family 2, subfamily C, polypeptide 9; cytochrome P450 2C9; cytochrome P-450MP; cytochrome P450 PB-1; microsomal monooxygenase; xenobiotic monooxygenase; flavoprotein-linked monooxygenase; cytochrome P-450 S-mephenytoin 4-hydroxylase; EC 1.14.13.48; EC 1.14.13.49; EC 1.14.13.80
Gene ID 1559
mRNA Refseq NM_000771
Protein Refseq NP_000762
MIM 601130
UniProt ID P11712
Chromosome Location 10q24
Pathway Arachidonate Epoxygenase / Epoxide Hydrolase; Arachidonic acid metabolism; Biological oxidations
Function (R)-limonene 6-monooxygenase activity; caffeine oxidase activity; electron carrier activity

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CYP2C9 Products

Required fields are marked with *

My Review for All CYP2C9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon