Recombinant Human CYP2C9, GST-tagged
Cat.No. : | CYP2C9-530H |
Product Overview : | Human CYP2C9 full-length ORF ( AAH20754.1, 1 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 162 a.a. |
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by rifampin. The enzyme is known to metabolize many xenobiotics, including phenytoin, tolbutamide, ibuprofen and S-warfarin. Studies identifying individuals who are poor metabolizers of phenytoin and tolbutamide suggest that this gene is polymorphic. The gene is located within a cluster of cytochrome P450 genes on chromosome 10q24. |
Molecular Mass : | 43.56 kDa |
AA Sequence : | MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIV VLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEAR CLVEELRKTKGG |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CYP2C9 cytochrome P450, family 2, subfamily C, polypeptide 9 [Homo sapiens (human) ] |
Official Symbol | CYP2C9 |
Synonyms | CYP2C9; CPC9; CYP2C; CYP2C10; CYPIIC9; P450IIC9; cytochrome P450, family 2, subfamily C, polypeptide 9; cytochrome P450 2C9; cytochrome P-450MP; cytochrome P450 PB-1; microsomal monooxygenase; xenobiotic monooxygenase; flavoprotein-linked monooxygenase; cytochrome P-450 S-mephenytoin 4-hydroxylase; EC 1.14.13.48; EC 1.14.13.49; EC 1.14.13.80 |
Gene ID | 1559 |
mRNA Refseq | NM_000771 |
Protein Refseq | NP_000762 |
MIM | 601130 |
UniProt ID | P11712 |
Chromosome Location | 10q24 |
Pathway | Arachidonate Epoxygenase / Epoxide Hydrolase; Arachidonic acid metabolism; Biological oxidations |
Function | (R)-limonene 6-monooxygenase activity; caffeine oxidase activity; electron carrier activity |
◆ Recombinant Proteins | ||
CYP2C9-976R | Recombinant Rhesus Macaque CYP2C9 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYP2C9-531H | Recombinant Human CYP2C9 protein, MYC/DDK-tagged | +Inquiry |
CYP2C9-35H | Recombinant Human CYP2C9/NADPH reductase protein | +Inquiry |
CYP2C9-543H | Active Recombinant Human CYP2C9 1(Wild type allele) | +Inquiry |
CYP2C9-363H | Recombinant Human CYP2C9/NADPH protein, Active | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP2C9-7113HCL | Recombinant Human CYP2C9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP2C9 Products
Required fields are marked with *
My Review for All CYP2C9 Products
Required fields are marked with *
0
Inquiry Basket