Recombinant Human CYP2C9, GST-tagged

• Cat.No.: CYP2C9-530H
• Product Overview: Human CYP2C9 full-length ORF ( AAH20754.1, 1 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by rifampin. The enzyme is known to metabolize many xenobiotics, including phenytoin, tolbutamide, ibuprofen and S-warfarin. Studies identifying individuals who are poor metabolizers of phenytoin and tolbutamide suggest that this gene is polymorphic. The gene is located within a cluster of cytochrome P450 genes on chromosome 10q24.
• Source: Wheat germ
• Species: Human
• Tag: GST
• Molecular Mass: 43.56 kDa
• Protein length: 1 a.a. - 162 a.a.
• AA Sequence: MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIV VLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEAR CLVEELRKTKGG
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CYP2C9 cytochrome P450, family 2, subfamily C, polypeptide 9 [Homo sapiens (human) ]
• Official Symbol: CYP2C9
• Synonyms: CYP2C9; CPC9; CYP2C; CYP2C10; CYPIIC9; P450IIC9; cytochrome P450, family 2, subfamily C, polypeptide 9; cytochrome P450 2C9; cytochrome P-450MP; cytochrome P450 PB-1; microsomal monooxygenase; xenobiotic monooxygenase; flavoprotein-linked monooxygenase; cytochrome P-450 S-mephenytoin 4-hydroxylase; EC 1.14.13.48; EC 1.14.13.49; EC 1.14.13.80
• Gene ID: 1559
• mRNA Refseq: NM_000771
• Protein Refseq: NP_000762
• MIM: 601130
• UniProt ID: P11712
• Chromosome Location: 10q24
• Pathway: Arachidonate Epoxygenase / Epoxide Hydrolase; Arachidonic acid metabolism; Biological oxidations
• Function: (R)-limonene 6-monooxygenase activity; caffeine oxidase activity; electron carrier activity