Recombinant Human CYP2C19 protein, His&Myc-tagged

• Cat.No.: CYP2C19-2793H
• Product Overview: Recombinant Human CYP2C19 protein(P33261)(26-490aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 26-490aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 60.6 kDa
• AA Sequence: RGKLPPGPTPLPVIGNILQIDIKDVSKSLTNLSKIYGPVFTLYFGLERMVVLHGYEVVKEALIDLGEEFSGRGHFPLAERANRGFGIVFSNGKRWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSIIFQKRFDYKDQQFLNLMEKLNENIRIVSTPWIQICNNFPTIIDYFPGTHNKLLKNLAFMESDILEKVKEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVVGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCDVKFRNYLIPKGTTILTSLTSVLHDNKEFPNPEMFDPRHFLDEGGNFKKSNYFMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKDLDTTPVVNGFASVPPFYQLCFIPV
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CYP2C19 cytochrome P450, family 2, subfamily C, polypeptide 19 [ Homo sapiens ]
• Official Symbol: CYP2C19
• Synonyms: CYP2C19; cytochrome P450, family 2, subfamily C, polypeptide 19; CYP2C, cytochrome P450, subfamily IIC (mephenytoin 4 hydroxylase), polypeptide 19; cytochrome P450 2C19; CPCJ; P450IIC19; CYPIIC17; CYPIIC19; cytochrome P450-11A; cytochrome P450-254C; cytochrome P-450 II C; microsomal monooxygenase; xenobiotic monooxygenase; mephenytoin 4-hydroxylase; S-mephenytoin 4-hydroxylase; (R)-limonene 6-monooxygenase; (S)-limonene 6-monooxygenase; (S)-limonene 7-monooxygenase; flavoprotein-linked monooxygenase; cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 19; CYP2C; P450C2C
• Gene ID: 1557
• mRNA Refseq: NM_000769
• Protein Refseq: NP_000760
• MIM: 124020
• UniProt ID: P33261