Recombinant Human CYP2A13 protein, His&Myc-tagged

• Cat.No.: CYP2A13-6335H
• Product Overview: Recombinant Human CYP2A13 protein(Q16696)(1-494aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1-494a.a.
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 64.1 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSNGERAKQLRRFSIATLRGFGVGKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFFAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQRFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKDIDVSPKHVGFATIPRNYTMSFLPR

Gene Information

• Gene Name: CYP2A13 cytochrome P450, family 2, subfamily A, polypeptide 13 [ Homo sapiens ]
• Official Symbol: CYP2A13
• Synonyms: CYP2A13; cytochrome P450, family 2, subfamily A, polypeptide 13; cytochrome P450, subfamily IIA (phenobarbital inducible), polypeptide 13; cytochrome P450 2A13; CPAD; CYP2A; cytochrome P450, subfamily IIA (phenobarbital-inducible), polypeptide 13; CYPIIA13
• Gene ID: 1553
• mRNA Refseq: NM_000766
• Protein Refseq: NP_000757
• MIM: 608055
• UniProt ID: Q16696