Recombinant Human CYP11B1 Protein (25-503 aa), His-SUMO-Myc-tagged
Cat.No. : | CYP11B1-2396H |
Product Overview : | Recombinant Human CYP11B1 Protein (25-503 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cancer. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 25-503 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 74.9 kDa |
AA Sequence : | GTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | CYP11B1 cytochrome P450, family 11, subfamily B, polypeptide 1 [ Homo sapiens ] |
Official Symbol | CYP11B1 |
Synonyms | CYP11B1; CPN1; FHI; P450C11; CYPXIB1; cytochrome P450C11; cytochrome P-450c11; CYP11B; FLJ36771; DKFZp686B05283; |
Gene ID | 1584 |
mRNA Refseq | NM_000497 |
Protein Refseq | NP_000488 |
MIM | 610613 |
UniProt ID | P15538 |
◆ Recombinant Proteins | ||
CYP11B1-2240H | Recombinant Human CYP11B1 Protein, GST-tagged | +Inquiry |
CYP11B1-1133R | Recombinant Rhesus monkey CYP11B1 Protein, His-tagged | +Inquiry |
CYP11B1-2292HF | Recombinant Full Length Human CYP11B1 Protein, GST-tagged | +Inquiry |
Cyp11b1-8080R | Recombinant Rat Cyp11b1 protein, His & T7-tagged | +Inquiry |
Cyp11b1-889M | Recombinant Mouse Cyp11b1 Protein, His&SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP11B1-7130HCL | Recombinant Human CYP11B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP11B1 Products
Required fields are marked with *
My Review for All CYP11B1 Products
Required fields are marked with *
0
Inquiry Basket