Recombinant Full Length Human CYP11B1 Protein, GST-tagged

• Cat.No.: CYP11B1-2292HF
• Product Overview: Human CYP11B1 full-length ORF ( AAH96285.1, 1 a.a. - 574 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 574 amino acids
• Description: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and is involved in the conversion of progesterone to cortisol in the adrenal cortex. Mutations in this gene cause congenital adrenal hyperplasia due to 11-beta-hydroxylase deficiency. Transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Jul 2008]
• Molecular Mass: 91.5 kDa
• AA Sequence: MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRSRHSASFGRWGRSAARAGLWRCQGRGWCRANPSSLQRGQDSEALKYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNVADRGNSSPPFPGGIHGAPTHSGCRNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CYP11B1 cytochrome P450, family 11, subfamily B, polypeptide 1 [ Homo sapiens ]
• Official Symbol: CYP11B1
• Synonyms: CYP11B1; cytochrome P450, family 11, subfamily B, polypeptide 1; CYP11B, cytochrome P450, subfamily XIB (steroid 11 beta hydroxylase), polypeptide 1; cytochrome P450 11B1, mitochondrial; CPN1; FHI; P450C11; CYPXIB1; cytochrome P450C11; cytochrome P-450c11; cytochrome p450 XIB1; steroid 11-beta-hydroxylase; steroid 11-beta-monooxygenase; cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 1; CYP11B; FLJ36771; DKFZp686B05283
• Gene ID: 1584
• mRNA Refseq: NM_000497
• Protein Refseq: NP_000488
• MIM: 610613
• UniProt ID: P15538