Recombinant Human CYGB, His-tagged

• Cat.No.: CYGB-26694TH
• Product Overview: Recombinant full length Human Cytoglobin with an N terminal His tag; 210aa, 23.5kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 190 amino acids
• Description: Cytoglobin is a ubiquitously expressed hexacoordinate hemoglobin that may facilitate diffusion of oxygen through tissues, scavenge nitric oxide or other reactive oxygen species, or serve a protective function during oxidative stress (Trent and Hargrove, 2002
• Conjugation: HIS
• Molecular Weight: 23.500kDa inclusive of tags
• Tissue specificity: Ubiquitously expressed. Highest expression in heart, stomach, bladder and small intestine.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP
• Sequence Similarities: Belongs to the globin family.

Gene Information

• Gene Name: CYGB cytoglobin [ Homo sapiens ]
• Official Symbol: CYGB
• Synonyms: CYGB; cytoglobin; HGB; histoglobin; STAP; stellate cell activation associated protein
• Gene ID: 114757
• mRNA Refseq: NM_134268
• Protein Refseq: NP_599030
• MIM: 608759
• Uniprot ID: Q8WWM9
• Chromosome Location: 17q25
• Function: heme binding; metal ion binding; oxygen binding; oxygen transporter activity; peroxidase activity