Recombinant Human CYGB, His-tagged
Cat.No. : | CYGB-26694TH |
Product Overview : | Recombinant full length Human Cytoglobin with an N terminal His tag; 210aa, 23.5kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 190 amino acids |
Description : | Cytoglobin is a ubiquitously expressed hexacoordinate hemoglobin that may facilitate diffusion of oxygen through tissues, scavenge nitric oxide or other reactive oxygen species, or serve a protective function during oxidative stress (Trent and Hargrove, 2002 |
Conjugation : | HIS |
Molecular Weight : | 23.500kDa inclusive of tags |
Tissue specificity : | Ubiquitously expressed. Highest expression in heart, stomach, bladder and small intestine. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP |
Sequence Similarities : | Belongs to the globin family. |
Gene Name | CYGB cytoglobin [ Homo sapiens ] |
Official Symbol | CYGB |
Synonyms | CYGB; cytoglobin; HGB; histoglobin; STAP; stellate cell activation associated protein; |
Gene ID | 114757 |
mRNA Refseq | NM_134268 |
Protein Refseq | NP_599030 |
MIM | 608759 |
Uniprot ID | Q8WWM9 |
Chromosome Location | 17q25 |
Function | heme binding; metal ion binding; oxygen binding; oxygen transporter activity; peroxidase activity; |
◆ Recombinant Proteins | ||
CYGB-957R | Recombinant Rhesus Macaque CYGB Protein, His (Fc)-Avi-tagged | +Inquiry |
CYGB-26694TH | Recombinant Human CYGB, His-tagged | +Inquiry |
CYGB-1731H | Recombinant Human CYGB Protein (Met1-Pro190), C-His tagged | +Inquiry |
Cygb-2784R | Recombinant Rat Cygb protein, His&Myc-tagged | +Inquiry |
Cygb-670R | Recombinant Rat Cygb Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYGB-7134HCL | Recombinant Human CYGB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYGB Products
Required fields are marked with *
My Review for All CYGB Products
Required fields are marked with *
0
Inquiry Basket