Recombinant Human CYB5R3 Protein, GST-tagged

• Cat.No.: CYB5R3-2218H
• Product Overview: Human CYB5R3 partial ORF ( AAH04821.1, 157 a.a. - 252 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes cytochrome b5 reductase, which includes a membrane-bound form in somatic cells (anchored in the endoplasmic reticulum, mitochondrial and other membranes) and a soluble form in erythrocytes. The membrane-bound form exists mainly on the cytoplasmic side of the endoplasmic reticulum and functions in desaturation and elongation of fatty acids, in cholesterol biosynthesis, and in drug metabolism. The erythrocyte form is located in a soluble fraction of circulating erythrocytes and is involved in methemoglobin reduction. The membrane-bound form has both membrane-binding and catalytic domains, while the soluble form has only the catalytic domain. Alternate splicing results in multiple transcript variants. Mutations in this gene cause methemoglobinemias. [provided by RefSeq, Jan 2010]
• Molecular Mass: 36.3 kDa
• AA Sequence: FAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CYB5R3 cytochrome b5 reductase 3 [ Homo sapiens ]
• Official Symbol: CYB5R3
• Synonyms: CYB5R3; cytochrome b5 reductase 3; DIA1, diaphorase (NADH) (cytochrome b 5 reductase); NADH-cytochrome b5 reductase 3; diaphorase-1; NADH-cytochrome b5 reductase 3 soluble form; NADH-cytochrome b5 reductase 3 membrane-bound form; B5R; DIA1
• Gene ID: 1727
• mRNA Refseq: NM_000398
• Protein Refseq: NP_000389
• MIM: 613213
• UniProt ID: P00387