Recombinant Human CXorf40B Protein, GST-tagged

• Cat.No.: CXorf40B-2195H
• Product Overview: Human CXorf40B full-length ORF (AAH09523.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CXorf40B (Chromosome X Open Reading Frame 40B) is a Protein Coding gene. An important paralog of this gene is CXorf40A.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 43.78 kDa
• AA Sequence: MKFGCLSFRQPYAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWEGDACRELLVERLGMTPAQIQALLRKGEKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAALTNLKQKYLTVISNPRWLLEPIPRKGGKDVFQVDIPEHLIPLGHEV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CXorf40B chromosome X open reading frame 40B [ Homo sapiens (human) ]
• Official Symbol: CXorf40B
• Synonyms: CXorf40B; chromosome X open reading frame 40B; Chromosome X Open Reading Frame 40B; protein CXorf40B
• Gene ID: 541578
• mRNA Refseq: NM_001013845
• Protein Refseq: NP_001013867
• UniProt ID: Q96DE9