Recombinant Full Length Human CXorf40B Protein, GST-tagged

Cat.No. : CXorf40B-2348HF
Product Overview : Human CXorf40B full-length ORF (AAH09523.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : CXorf40B (Chromosome X Open Reading Frame 40B) is a Protein Coding gene. An important paralog of this gene is CXorf40A.
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 43.78 kDa
Protein length : 158 amino acids
AA Sequence : MKFGCLSFRQPYAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWEGDACRELLVERLGMTPAQIQALLRKGEKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAALTNLKQKYLTVISNPRWLLEPIPRKGGKDVFQVDIPEHLIPLGHEV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CXorf40B chromosome X open reading frame 40B [ Homo sapiens (human) ]
Official Symbol CXorf40B
Synonyms CXorf40B; chromosome X open reading frame 40B; Chromosome X Open Reading Frame 40B; protein CXorf40B
Gene ID 541578
mRNA Refseq NM_001013845
Protein Refseq NP_001013867
UniProt ID Q96DE9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CXorf40B Products

Required fields are marked with *

My Review for All CXorf40B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon