Recombinant Human CXCL10, StrepII-tagged
Cat.No. : | CXCL10-274H |
Product Overview : | Purified, full-length human recombinant CXCL10 protein (amino acids 22-98, 77 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 8.2 kDa. (Accession NP_001556; UniProt P02778) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 22-98, 77 a.a. |
Description : | CXCL10 is a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR2 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. In addition, CXCL10 is a chemotactic factor that attracts monocytes and T-lymphocytes. CXCL10 is induced by IFNG. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free) |
AA Sequence : | MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCL NPESKAIKNLLKAVSKERSKRSP |
Endotoxin : | <0.1 eu per μg protein by lal |
Purity : | >85% by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml |
Gene Name | CXCL10 chemokine (C-X-C motif) ligand 10 [ Homo sapiens ] |
Official Symbol | CXCL10 |
Synonyms | CXCL10; chemokine (C-X-C motif) ligand 10; INP10, SCYB10, small inducible cytokine subfamily B (Cys X Cys), member 10; C-X-C motif chemokine 10; C7; crg 2; gIP 10; IFI10; IP 10; mob 1; gamma IP10; gamma-IP10; small-inducible cytokine B10; interferon-inducible cytokine IP-10; 10 kDa interferon gamma-induced protein; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10; |
Gene ID | 3627 |
mRNA Refseq | NM_001565 |
Protein Refseq | NP_001556 |
MIM | 147310 |
UniProt ID | P02778 |
Chromosome Location | 4q21 |
Pathway | CXCR3-mediated signaling events, organism-specific biosystem; Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; |
Function | cAMP-dependent protein kinase regulator activity; chemokine activity; receptor binding; |
◆ Recombinant Proteins | ||
CXCL10-938R | Recombinant Rat CXCL10 Protein (Ile22-Pro98), His-tagged | +Inquiry |
Cxcl10-076M | Recombinant Mouse Cxcl10 Protein, MYC/DDK-tagged | +Inquiry |
CXCL10-5006H | Recombinant Human CXCL10 protein, His-tagged | +Inquiry |
CXCL10-101H | Recombinant Human CXCL10 Protein, DYKDDDDK-tagged | +Inquiry |
CXCL10-4342C | Recombinant Caprine CXCL10 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL10-7172HCL | Recombinant Human CXCL10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCL10 Products
Required fields are marked with *
My Review for All CXCL10 Products
Required fields are marked with *
0
Inquiry Basket