Recombinant Human CXCL10, StrepII-tagged

• Cat.No.: CXCL10-274H
• Product Overview: Purified, full-length human recombinant CXCL10 protein (amino acids 22-98, 77 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 8.2 kDa. (Accession NP_001556; UniProt P02778)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 22-98, 77 a.a.
• Description: CXCL10 is a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR2 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. In addition, CXCL10 is a chemotactic factor that attracts monocytes and T-lymphocytes. CXCL10 is induced by IFNG.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
• AA Sequence: MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCL NPESKAIKNLLKAVSKERSKRSP
• Endotoxin: <0.1 eu per μg protein by lal
• Purity: >85% by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml

Gene Information

• Gene Name: CXCL10 chemokine (C-X-C motif) ligand 10 [ Homo sapiens ]
• Official Symbol: CXCL10
• Synonyms: CXCL10; chemokine (C-X-C motif) ligand 10; INP10, SCYB10, small inducible cytokine subfamily B (Cys X Cys), member 10; C-X-C motif chemokine 10; C7; crg 2; gIP 10; IFI10; IP 10; mob 1; gamma IP10; gamma-IP10; small-inducible cytokine B10; interferon-inducible cytokine IP-10; 10 kDa interferon gamma-induced protein; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10
• Gene ID: 3627
• mRNA Refseq: NM_001565
• Protein Refseq: NP_001556
• MIM: 147310
• UniProt ID: P02778
• Chromosome Location: 4q21
• Pathway: CXCR3-mediated signaling events, organism-specific biosystem; Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem
• Function: cAMP-dependent protein kinase regulator activity; chemokine activity; receptor binding