Recombinant Human CXCL10 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: CXCL10-050H
• Product Overview: CXCL10 MS Standard C13 and N15-labeled recombinant protein (NP_001556) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression.
• Molecular Mass: 10.9 kDa
• AA Sequence: MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CXCL10 C-X-C motif chemokine ligand 10 [ Homo sapiens (human) ]
• Official Symbol: CXCL10
• Synonyms: CXCL10; C-X-C motif chemokine ligand 10; C7; crg-2; gIP-10; IFI10; INP10; IP-10; mob-1; SCYB10; C-X-C motif chemokine 10; 10 kDa interferon gamma-induced protein; gamma IP10; interferon-inducible cytokine IP-10; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10; small-inducible cytokine B10
• Gene ID: 3627
• mRNA Refseq: NM_001565
• Protein Refseq: NP_001556
• MIM: 147310
• UniProt ID: P02778