Recombinant Human CXCL10 Protein, Fc/His-tagged
Cat.No. : | CXCL10-025H |
Product Overview : | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 10 (CXCL10) was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc&His |
Description : | Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. |
Molecular Mass : | 36.6 kDa |
AA Sequence : | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Gene Name | CXCL10 chemokine (C-X-C motif) ligand 10 [ Homo sapiens ] |
Official Symbol | CXCL10 |
Synonyms | CXCL10; chemokine (C-X-C motif) ligand 10; INP10, SCYB10, small inducible cytokine subfamily B (Cys X Cys), member 10; C-X-C motif chemokine 10; C7; crg 2; gIP 10; IFI10; IP 10; mob 1; gamma IP10; gamma-IP10; small-inducible cytokine B10; interferon-inducible cytokine IP-10; 10 kDa interferon gamma-induced protein; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10; |
Gene ID | 3627 |
mRNA Refseq | NM_001565 |
Protein Refseq | NP_001556 |
MIM | 147310 |
UniProt ID | P02778 |
◆ Recombinant Proteins | ||
CXCL10-133B | Recombinant Bovine Chemokine (C-X-C motif) Ligand 10 | +Inquiry |
CXCL10-691H | Recombinant Human CXCL10 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCL10-2226HF | Recombinant Full Length Human CXCL10 Protein, GST-tagged | +Inquiry |
CXCL10-5387H | Recombinant Human CXCL10 protein, His-tagged | +Inquiry |
CXCL10-5006H | Recombinant Human CXCL10 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL10-7172HCL | Recombinant Human CXCL10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCL10 Products
Required fields are marked with *
My Review for All CXCL10 Products
Required fields are marked with *
0
Inquiry Basket