Recombinant Human CXCL10 Protein, Fc/His-tagged

• Cat.No.: CXCL10-025H
• Product Overview: Purified recombinant protein of Human chemokine (C-X-C motif) ligand 10 (CXCL10) was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc&His
• Description: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.
• Molecular Mass: 36.6 kDa
• AA Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: > 95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4

Gene Information

• Gene Name: CXCL10 chemokine (C-X-C motif) ligand 10 [ Homo sapiens ]
• Official Symbol: CXCL10
• Synonyms: CXCL10; chemokine (C-X-C motif) ligand 10; INP10, SCYB10, small inducible cytokine subfamily B (Cys X Cys), member 10; C-X-C motif chemokine 10; C7; crg 2; gIP 10; IFI10; IP 10; mob 1; gamma IP10; gamma-IP10; small-inducible cytokine B10; interferon-inducible cytokine IP-10; 10 kDa interferon gamma-induced protein; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10
• Gene ID: 3627
• mRNA Refseq: NM_001565
• Protein Refseq: NP_001556
• MIM: 147310
• UniProt ID: P02778