Recombinant Human CXCL10, His-tagged

• Cat.No.: CXCL10-31H
• Product Overview: A DNA sequence encoding human CXCL10(Q9UBH0) corresponding to amino acid (1-98) was expressed with a C-terminal polyhistidine tag.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 1-98 a.a.
• Description: CXCL10, also known as crg-2, belongs to the intercrine alpha (chemokine CxC) family. CXC chemokines are particularly significant for leukocyte infiltration in inflammatory diseases. With a three-dimensional crystal structure, CXCL10’s signaling is mediated by the g protein-coupled receptor CXCR3, which is expressed on activated T cells and plays an important role in directing the migration of T cells, especially during Th1 responses. It is secreted by monocytes, epithelial cells, and endothelial cells in response to IFN gamma or other pro-inflammatory cytokines and stimuli. Binding of CXCL10 to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. It is chemotactic for monocytes and T-lymphocytes. Baseline pre-treatment plasma levels of CXCL10 are elevated in patients chronically infected with hepatitis C virus (HCV) of genotypes 1 or 4.
• Form: PBS pH7.4
• Molecular Mass: The mature form of human CXCL10 consists of 78 amino acids (Val22-Pro98) and has a predicted molecular mass of 8.8kDa. In SDS-PAGE under reducing conditions, it migrates with an apparent molecular mass of 15KDa.
• AA Sequence: MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCL NPESKAIKNLLKAVSKERSKRSP
• Purity: > 90% by SDS - PAGE
• Storage: Store it at +4°C for short term. For long term storage, store it at -20°C - -70°C. Avoid freeze-thaw cycles.

Gene Information

• Gene Name: CXCL10 chemokine (C-X-C motif) ligand 10 [ Homo sapiens ]
• Official Symbol: CXCL10
• Synonyms: CXCL10; chemokine (C-X-C motif) ligand 10; INP10, SCYB10, small inducible cytokine subfamily B (Cys X Cys), member 10; C-X-C motif chemokine 10; C7; crg 2; gIP 10; IFI10; IP 10; mob 1; gamma IP10; gamma-IP10; small-inducible cytokine B10; interferon-inducible cytokine IP-10; 10 kDa interferon gamma-induced protein; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10
• Gene ID: 3627
• mRNA Refseq: NM_001565
• Protein Refseq: NP_001556
• MIM: 147310
• UniProt ID: P02778
• Chromosome Location: 4q21
• Pathway: CXCR3-mediated signaling events, organism-specific biosystem; Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem
• Function: cAMP-dependent protein kinase regulator activity; chemokine activity; receptor binding