Recombinant Human CXCL1 protein
Cat.No. : | CXCL1-14H |
Product Overview : | Recombinant Human CXCL1 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 73 |
Description : | CXCL1 is belonging to the CXC chemokine family. It is encoded by the GRO gene now designated CXCL1. The gene for CXCL1 was initially discovered in hamster cells. In addition to the GRO gene, two GRO genes, GROβ and GROγ share 90 % and 86 % amino acid sequence identity with CXCL1/GROα. All three human GROs are members of the intercrine alpha (chemokine C-X-C) subfamily of chemokine. CXCL1 is secreted by human melanoma cells, and also expressed by macrophages, neutrophils and epithelial cells. The functional receptor for CXCL1 has been identified as CXCR2. CXCL1 has chemotactic activity for neutrophils, and plays a role in inflammation and wound healing. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration range of 10-50 ng/ml. |
Molecular Mass : | Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 73 amino acids. |
AA Sequence : | ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN |
Endotoxin : | Less than 1 EU/µg of rHuGRO-α/CXCL1 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CXCL1 |
Official Symbol | CXCL1 |
Synonyms | CXCL1; chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha); fibroblast secretory protein , FSP, GRO1, GRO1 oncogene (melanoma growth stimulating activity, alpha) , MGSA; growth-regulated alpha protein; GROa; MGSA a; NAP 3; SCYB1; MGSA alpha; GRO-alpha(1-73); C-X-C motif chemokine 1; fibroblast secretory protein; neutrophil-activating protein 3; melanoma growth stimulatory activity alpha; GRO1 oncogene (melanoma growth-stimulating activity); GRO1 oncogene (melanoma growth stimulating activity, alpha); FSP; GRO1; MGSA; NAP-3; MGSA-a; |
Gene ID | 2919 |
mRNA Refseq | NM_001511 |
Protein Refseq | NP_001502 |
MIM | 155730 |
UniProt ID | P09341 |
◆ Native Proteins | ||
CXCL1-27707TH | Native Human CXCL1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL1-425HCL | Recombinant Human CXCL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCL1 Products
Required fields are marked with *
My Review for All CXCL1 Products
Required fields are marked with *
0
Inquiry Basket