Active Recombinant Rat Cxcl1 Protein
Cat.No. : | Cxcl1-187C |
Product Overview : | Recombinant Rat Cxcl1 Protein without tag was expressed in HEK 293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | HEK293 |
Description : | GRO/MGSA/CXCL1 has chemotactic activity for neutrophils. It may play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. All three isoforms of GRO are CXC chemokines that can signal through the CXCR1 or CXCR2 receptors. GRO expression is inducible by serum or PDGF and/or by a variety of inflammatory mediators, such as IL-1 and TNF, in monocytes, fibroblasts, melanocytes and epithelial cells. In certain tumor cell lines, GRO is expressed constitutively. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Active, measured in a functional assay using HUVEC cells. |
Molecular Mass : | ~7.8 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | APVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Rat GRO/MGSA/CXCL1 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat GRO/MGSA/CXCL1 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Cxcl1 chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) [ Rattus norvegicus ] |
Official Symbol | Cxcl1 |
Synonyms | CXCL1; chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha); growth-regulated alpha protein; gro; C-X-C motif chemokine 1; cytokine-induced neutrophil chemoattractant 1; platelet-derived growth factor-inducible protein KC; Gro1; CINC-1; |
Gene ID | 81503 |
mRNA Refseq | NM_030845 |
Protein Refseq | NP_110472 |
UniProt ID | G3V6C6 |
◆ Recombinant Proteins | ||
Cxcl1-5248M | Recombinant Mouse Cxcl1 protein, His-tagged | +Inquiry |
CXCL1-1686R | Recombinant Rat CXCL1 Protein | +Inquiry |
CXCL1-134H | Active Recombinant Human CXCL1 Protein (Ala35-Asn107), N-His tagged, Animal-free, Carrier-free | +Inquiry |
CXCL1-001H | Recombinant Human CXCL1 Protein, MBP-tagged | +Inquiry |
CXCL1-281H | Recombinant Human CXCL1, StrepII-tagged | +Inquiry |
◆ Native Proteins | ||
CXCL1-27707TH | Native Human CXCL1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL1-425HCL | Recombinant Human CXCL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cxcl1 Products
Required fields are marked with *
My Review for All Cxcl1 Products
Required fields are marked with *
0
Inquiry Basket