Recombinant Human CUX1 Protein, GST-tagged

• Cat.No.: CUX1-2139H
• Product Overview: Human CUTL1 partial ORF ( NP_001904.2, 521 a.a. - 620 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a member of the homeodomain family of DNA binding proteins. It may regulate gene expression, morphogenesis, and differentiation and it may also play a role in the cell cycle progession. Several alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Feb 2011]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CUX1 cut-like homeobox 1 [ Homo sapiens ]
• Official Symbol: CUX1
• Synonyms: CUX1; cut-like homeobox 1; cut (Drosophila) like 1 (CCAAT displacement protein) , cut like 1, CCAAT displacement protein (Drosophila) , CUTL1; protein CASP; CASP; CDP; CDP/Cut; CDP/Cux; CDP1; Clox; CUT; CUX; Cux/CDP; golgi integral membrane protein 6; GOLIM6; cut homolog; homeobox protein cux-1; CCAAT displacement protein; putative protein product of Nbla10317; p75; COY1; p100; p110; p200; CUTL1; Nbla10317; FLJ31745
• Gene ID: 1523
• mRNA Refseq: NM_001202543
• Protein Refseq: NP_001189472
• MIM: 116896
• UniProt ID: P39880