Recombinant Human CUX1 Protein, GST-tagged
Cat.No. : | CUX1-2139H |
Product Overview : | Human CUTL1 partial ORF ( NP_001904.2, 521 a.a. - 620 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the homeodomain family of DNA binding proteins. It may regulate gene expression, morphogenesis, and differentiation and it may also play a role in the cell cycle progession. Several alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Feb 2011] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CUX1 cut-like homeobox 1 [ Homo sapiens ] |
Official Symbol | CUX1 |
Synonyms | CUX1; cut-like homeobox 1; cut (Drosophila) like 1 (CCAAT displacement protein) , cut like 1, CCAAT displacement protein (Drosophila) , CUTL1; protein CASP; CASP; CDP; CDP/Cut; CDP/Cux; CDP1; Clox; CUT; CUX; Cux/CDP; golgi integral membrane protein 6; GOLIM6; cut homolog; homeobox protein cux-1; CCAAT displacement protein; putative protein product of Nbla10317; p75; COY1; p100; p110; p200; CUTL1; Nbla10317; FLJ31745; |
Gene ID | 1523 |
mRNA Refseq | NM_001202543 |
Protein Refseq | NP_001189472 |
MIM | 116896 |
UniProt ID | P39880 |
◆ Recombinant Proteins | ||
CUX1-2756H | Recombinant Human CUX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CUX1-2139H | Recombinant Human CUX1 Protein, GST-tagged | +Inquiry |
CUX1-3332H | Recombinant Human CUX1 protein, His-tagged | +Inquiry |
CUX1-5492C | Recombinant Chicken CUX1 | +Inquiry |
CUX1-11709H | Recombinant Human CUX1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CUX1-424HCL | Recombinant Human CUX1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CUX1 Products
Required fields are marked with *
My Review for All CUX1 Products
Required fields are marked with *
0
Inquiry Basket