Recombinant Human CTSL3P Protein, GST-tagged

Cat.No. : CTSL3P-2116H
Product Overview : Human CTSL3 full-length ORF ( AAI60188.1, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CTSL3P (Cathepsin L Family Member 3, Pseudogene) is a Pseudogene. GO annotations related to this gene include cysteine-type peptidase activity.
Molecular Mass : 24 kDa
AA Sequence : MKMIEQHNQEYREGKHSFTMAMNAFGEMTSEEFRQVVNGFQNQKHRKGKVLQEPLLHDIRKSVDWREKGYVTPVKDQCSWGSVRTDVRKTEKLVSLSVQTWWTALGFKAMLAAFLENHYFASSMLPTMEAWTLRNPFHMKKSSGDWKVQGHRGASGESLLASGESQQSPEVAQYSGKHQVQCHLIEEALQMLSGGDEDHDEDKWPHDMRNHLAGEAQV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CTSL3P cathepsin L family member 3, pseudogene [ Homo sapiens (human) ]
Official Symbol CTSL3P
Synonyms CTSL3P; cathepsin L family member 3, pseudogene; Cathepsin L Family Member 3, Pseudogene; HCTSL-S; CTSL3; Cathepsin L Family Member 3; Cathepsin L-Like Protein; Cathepsin L3 Pseudogene; EC 3.4.22
Gene ID 392360
UniProt ID Q5NE16

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CTSL3P Products

Required fields are marked with *

My Review for All CTSL3P Products

Required fields are marked with *

0

Inquiry Basket

cartIcon