Recombinant Full Length Upf0060 Membrane Protein Mb2672C (Mb2672C) Protein, His-Tagged
Cat.No. : | RFL4469MF |
Product Overview : | Recombinant Full Length UPF0060 membrane protein Mb2672c (Mb2672c) Protein (P67147) (1-110aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-110) |
Form : | Lyophilized powder |
AA Sequence : | MVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPDAHFGR VLAAYGGVFVAGSLAWGMALDGFRPDRWDVIGALGCMAGVAVIMYAPRGH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BQ2027_MB2672C |
Synonyms | BQ2027_MB2672C; UPF0060 membrane protein Mb2672c |
UniProt ID | P67147 |
◆ Native Proteins | ||
Thromboplastin-079B | Native Bovine Thromboplastin Protein | +Inquiry |
FSH-1566P | Active Native Porcine Stimulating Hormone | +Inquiry |
Thrombin-24H | Active Native Human a-Thrombin | +Inquiry |
TNC-08H | Native Human TNC Protein | +Inquiry |
FSH-93P | Active Native Porcine FSH | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLK-1681HCL | Recombinant Human SLK 293 Cell Lysate | +Inquiry |
RAX-2492HCL | Recombinant Human RAX 293 Cell Lysate | +Inquiry |
TCP11L2-1165HCL | Recombinant Human TCP11L2 293 Cell Lysate | +Inquiry |
RNF217-548HCL | Recombinant Human RNF217 lysate | +Inquiry |
PXK-2653HCL | Recombinant Human PXK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BQ2027_MB2672C Products
Required fields are marked with *
My Review for All BQ2027_MB2672C Products
Required fields are marked with *
0
Inquiry Basket