Recombinant Human CTNNBIP1 Protein, GST-tagged

• Cat.No.: CTNNBIP1-2084H
• Product Overview: Human CTNNBIP1 full-length ORF ( ABZ92405.1, 1 a.a. - 81 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
• Molecular Mass: 9 kDa
• AA Sequence: MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CTNNBIP1 catenin, beta interacting protein 1 [ Homo sapiens ]
• Official Symbol: CTNNBIP1
• Synonyms: CTNNBIP1; catenin, beta interacting protein 1; beta-catenin-interacting protein 1; beta catenin interacting protein ICAT; ICAT; inhibitor of beta catenin and Tcf 4; MGC15093; inhibitor of beta-catenin and Tcf-4; beta-catenin-interacting protein ICAT
• Gene ID: 56998
• mRNA Refseq: NM_001012329
• Protein Refseq: NP_001012329
• MIM: 607758
• UniProt ID: Q9NSA3