Recombinant Full Length Human CTNNBIP1 Protein, GST-tagged

Cat.No. : CTNNBIP1-2318HF
Product Overview : Human CTNNBIP1 full-length ORF ( ABZ92405.1, 1 a.a. - 81 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 81 amino acids
Description : The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 9 kDa
AA Sequence : MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CTNNBIP1 catenin, beta interacting protein 1 [ Homo sapiens ]
Official Symbol CTNNBIP1
Synonyms CTNNBIP1; catenin, beta interacting protein 1; beta-catenin-interacting protein 1; beta catenin interacting protein ICAT; ICAT; inhibitor of beta catenin and Tcf 4; MGC15093; inhibitor of beta-catenin and Tcf-4; beta-catenin-interacting protein ICAT;
Gene ID 56998
mRNA Refseq NM_001012329
Protein Refseq NP_001012329
MIM 607758
UniProt ID Q9NSA3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CTNNBIP1 Products

Required fields are marked with *

My Review for All CTNNBIP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon