Recombinant Human CTNNBIP1, His-tagged

• Cat.No.: CTNNBIP1-28030TH
• Product Overview: Recombinant full length Human CTNNBIP1 with N terminal His tag; 101 amino acids with tag, MWt 11.3kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 81 amino acids
• Description: The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene.
• Conjugation: HIS
• Molecular Weight: 11.300kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ
• Sequence Similarities: Belongs to the CTNNBIP1 family.

Gene Information

• Gene Name: CTNNBIP1 catenin, beta interacting protein 1 [ Homo sapiens ]
• Official Symbol: CTNNBIP1
• Synonyms: CTNNBIP1; catenin, beta interacting protein 1; beta-catenin-interacting protein 1; beta catenin interacting protein ICAT; ICAT; inhibitor of beta catenin and Tcf 4; MGC15093
• Gene ID: 56998
• mRNA Refseq: NM_001012329
• Protein Refseq: NP_001012329
• MIM: 607758
• Uniprot ID: Q9NSA3
• Chromosome Location: 1pter-p36.31
• Pathway: Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem; Wnt Signaling Pathway NetPath, organism-specific biosystem; Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem
• Function: armadillo repeat domain binding; beta-catenin binding; beta-catenin binding; protein binding