Source :	E. coli
Species :	Human
Tag :	His
Protein length :	61-170 aa
Form :	0.15 M Phosphate buffered saline
AASequence :	QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNK
Storage :	Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution :	It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Name	CTNNB1 catenin (cadherin-associated protein), beta 1, 88kDa [ Homo sapiens ]
Official Symbol	CTNNB1
Synonyms	CTNNB1; catenin (cadherin-associated protein), beta 1, 88kDa; catenin (cadherin associated protein), beta 1 (88kD) , CTNNB; catenin beta-1; beta catenin; CTNNB; FLJ25606; FLJ37923; DKFZp686D02253;
Gene ID	1499
mRNA Refseq	NM_001098209
Protein Refseq	NP_001091679
MIM	116806
UniProt ID	P35222