Recombinant Human CTH Protein

• Cat.No.: CTH-929H
• Product Overview: Recombinant Human CTH, transcript variant 1, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: This gene encodes a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in this gene cause cystathioninuria. Alternative splicing of this gene results in three transcript variants encoding different isoforms.
• Form: Supplied as a 0.2 µM filtered solution of PBS, pH 7.4
• Molecular Mass: 44.7kD
• AA Sequence: GHMQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCY
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: CTH cystathionase (cystathionine gamma-lyase) [ Homo sapiens ]
• Official Symbol: CTH
• Synonyms: CTH; cystathionase (cystathionine gamma-lyase); cystathionine gamma-lyase; gamma-cystathionase; homoserine deaminase; cysteine desulfhydrase; homoserine dehydratase; cysteine-protein sulfhydrase; MGC9471
• Gene ID: 1491
• mRNA Refseq: NM_001190463
• Protein Refseq: NP_001177392
• MIM: 607657
• UniProt ID: P32929