Recombinant Human CTAG2 protein, His-SUMO-tagged

• Cat.No.: CTAG2-2751H
• Product Overview: Recombinant Human CTAG2 protein(O75638)(1-210aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-210aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 37.1 kDa
• AA Sequence: MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CTAG2 cancer/testis antigen 2 [ Homo sapiens ]
• Official Symbol: CTAG2
• Synonyms: CTAG2; cancer/testis antigen 2; CAMEL; cancer/testis antigen family 6; member 2a; member 2b; CT6.2a; CT6.2b; CTL recognized antigen on melanoma; ESO2; LAGE 1; LAGE 1a; LAGE 1a protein; LAGE 1b; LAGE1; MGC3803; MGC138724; LAGE-1a protein; cancer/testis antigen 6.2; l antigen family member 1; CTL-recognized antigen on melanoma; cancer/testis antigen family 6, member 2a; cancer/testis antigen family 6, member 2b; autoimmunogenic cancer/testis antigen NY-ESO-2; CT2; CT6.2; LAGE-1; LAGE2B
• Gene ID: 30848
• mRNA Refseq: NM_020994
• Protein Refseq: NP_066274
• MIM: 300396
• UniProt ID: O75638