Recombinant Human CTAG2 Protein (1-210 aa), His-sumostar-tagged

• Cat.No.: CTAG2-2471H
• Product Overview: Recombinant Human CTAG2 Protein (1-210 aa) is produced by Yeast expression system. This protein is fused with a 6xHis-sumostar tag at the N-terminal. Protein Description: Full Length.

Specification

• Source: Yeast
• Species: Human
• Tag: His&SUMO
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 37.1 kDa
• Protein length: 1-210 aa
• AA Sequence: MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: CTAG2 cancer/testis antigen 2 [ Homo sapiens ]
• Official Symbol: CTAG2
• Synonyms: CTAG2; CAMEL; member 2a; member 2b; CT6.2a; CT6.2b; ESO2; LAGE 1; LAGE 1a; LAGE 1a protein; LAGE 1b; LAGE1; MGC3803; MGC138724; LAGE-1a protein; CT2; CT6.2; LAGE-1; LAGE2B
• Gene ID: 30848
• mRNA Refseq: NM_020994
• Protein Refseq: NP_066274
• MIM: 300396
• UniProt ID: O75638