Recombinant Human CSTA Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CSTA-1891H
• Product Overview: CSTA MS Standard C13 and N15-labeled recombinant protein (NP_005204) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins, and kininogens. This gene encodes a stefin that functions as a cysteine protease inhibitor, forming tight complexes with papain and the cathepsins B, H, and L. The protein is one of the precursor proteins of cornified cell envelope in keratinocytes and plays a role in epidermal development and maintenance. Stefins have been proposed as prognostic and diagnostic tools for cancer.
• Molecular Mass: 11 kDa
• AA Sequence: MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CSTA cystatin A [ Homo sapiens (human) ]
• Official Symbol: CSTA
• Synonyms: CSTA; cystatin A; AREI; PSS4; STF1; STFA; cystatin-A; cystatin A (stefin A); cystatin AS
• Gene ID: 1475
• mRNA Refseq: NM_005213
• Protein Refseq: NP_005204
• MIM: 184600
• UniProt ID: P01040