Recombinant Human CSTA protein

Cat.No. : CSTA-213H
Product Overview : Recombinant Human Cystatin A is produced with our E. coli expression system. The target protein is expressed with sequence (Ile2-Phe98) of Human Cystatin A.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 2-98 a.a.
Form : Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 100mM NaCl, pH 8.0.
AA Sequence : MHHHHHHIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKV FKSLPGQNEDLVLTGYQVDKNKDDELTGF
Endotoxin : < 1.0 EU per μg of the protein as determined by the LAL method.
Purity : > 95 % as determined by SDS-PAGE.
Stability : Samples are stable for up to twelve months from date of receipt at -70 centigrade.
Storage : Store it under sterile conditions at -20℃~-70℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4℃ before opening to recover the entire contents.
Gene Name CSTA cystatin A [ Homo sapiens ]
Official Symbol CSTA
Synonyms AREI; STF1; STFA; cystatin A (stefin A); cystatin AS
Gene ID 1475
mRNA Refseq NM_005213
Protein Refseq NP_005204
MIM 184600
UniProt ID P01040
Chromosome Location 3q21
Function cysteine-type endopeptidase inhibitor activity; protease binding; structural molecule activity

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CSTA Products

Required fields are marked with *

My Review for All CSTA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon