Recombinant Human CST9, His-tagged
Cat.No. : | CST9-26433TH |
Product Overview : | Recombinant full length Human CST9 with N terminal His tag; 152 amino acids with tag, Predicted MWt 17.2 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 131 amino acids |
Description : | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a secreted protein that may play a role in hematopoietic differentiation or inflammation. |
Conjugation : | HIS |
Molecular Weight : | 17.200kDa inclusive of tags |
Tissue specificity : | Expressed in heart, placenta, lung, liver, skeletal muscle and pancreas. Not expressed in brain. Barely expressed in tumor cell lines except for breast adenocarcinoma MCF-7 cells and U251 cells. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 2.4% Urea, 10% Glycerol |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMWCSEEEMGGNNKIVQDPMF LATVEFALNTFNVQSKEEHAYRLLRVLSSWREDSMDRK WRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLELNNVR QGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK |
Sequence Similarities : | Belongs to the cystatin family. |
Gene Name | CST9 cystatin 9 (testatin) [ Homo sapiens ] |
Official Symbol | CST9 |
Synonyms | CST9; cystatin 9 (testatin); cystatin-9; CLM; |
Gene ID | 128822 |
mRNA Refseq | NM_001008693 |
Protein Refseq | NP_001008693 |
Uniprot ID | Q5W186 |
Chromosome Location | 20p11.21 |
Function | cysteine-type endopeptidase inhibitor activity; peptidase inhibitor activity; |
◆ Recombinant Proteins | ||
CST9-2035H | Recombinant Human CST9 Protein, His-tagged | +Inquiry |
CST9-2036M | Recombinant Mouse CST9 Protein, His (Fc)-Avi-tagged | +Inquiry |
CST9-6892H | Recombinant Human Cystatin 9 (testatin), His-tagged | +Inquiry |
CST9-4001M | Recombinant Mouse CST9 Protein | +Inquiry |
CST9-26433TH | Recombinant Human CST9, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CST9 Products
Required fields are marked with *
My Review for All CST9 Products
Required fields are marked with *
0
Inquiry Basket