Recombinant Human CST9 Protein, His-tagged
Cat.No. : | CST9-2035H |
Product Overview : | Human CST9 (NP_001008693, 29 a.a. - 159 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 29-159 a.a. |
Description : | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a secreted protein that may play a role in hematopoietic differentiation or inflammation. [provided by RefSeq, Jul 2008] |
Form : | Liquid |
Molecular Mass : | 17.2 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMWCSEEEMGGNNKIVQDPMFLATVEFALNTFNVQSKEEHAYRLLRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | 1 mg/mL |
Storage Buffer : | In 20 mM Tris-HCl. pH 8.0. (10% glycerol, 0.4 M urea) |
Gene Name | CST9 cystatin 9 (testatin) [ Homo sapiens ] |
Official Symbol | CST9 |
Synonyms | CST9; cystatin 9 (testatin); cystatin-9; CLM; cystatin-like molecule; |
Gene ID | 128822 |
mRNA Refseq | NM_001008693 |
Protein Refseq | NP_001008693 |
MIM | 616543 |
UniProt ID | Q5W186 |
◆ Recombinant Proteins | ||
CST9-4001M | Recombinant Mouse CST9 Protein | +Inquiry |
CST9-11647H | Recombinant Human CST9, GST-tagged | +Inquiry |
CST9-6892H | Recombinant Human Cystatin 9 (testatin), His-tagged | +Inquiry |
CST9-2035H | Recombinant Human CST9 Protein, His-tagged | +Inquiry |
CST9-2036M | Recombinant Mouse CST9 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CST9 Products
Required fields are marked with *
My Review for All CST9 Products
Required fields are marked with *
0
Inquiry Basket