Recombinant Human CST5 Protein, His-tagged
Cat.No. : | CST5-187H |
Product Overview : | Recombinant human CST5 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 142 |
Description : | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein found in saliva and tears. The encoded protein may play a protective role against proteinases present in the oral cavity. |
Form : | Lyophilized |
Molecular Mass : | 14.7 kDa |
AA Sequence : | MMWPMHTPLLLLTALMVAVAGSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CST5 cystatin D [ Homo sapiens (human) ] |
Official Symbol | CST5 |
Synonyms | CST5; cystatin D; cystatin-D; cystatin 5; cystatin-5; cysteine-proteinase inhibitor; MGC71922; |
Gene ID | 1473 |
mRNA Refseq | NM_001900 |
Protein Refseq | NP_001891 |
MIM | 123858 |
UniProt ID | P28325 |
◆ Recombinant Proteins | ||
CST5-494H | Active Recombinant Human CST5, His-tagged | +Inquiry |
CST5-1854H | Recombinant Human CST5 protein(Met1-Val142), His-tagged | +Inquiry |
CST5-102H | Recombinant Human CST5, His-tagged | +Inquiry |
CST5-187H | Recombinant Human CST5 Protein, His-tagged | +Inquiry |
CST5-675H | Recombinant Human CST5 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CST5-3027HCL | Recombinant Human CST5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CST5 Products
Required fields are marked with *
My Review for All CST5 Products
Required fields are marked with *
0
Inquiry Basket