Recombinant Human CSNK2A2 Protein, Full Length, N-His tagged

Cat.No. : CSNK2A2-13HFL
Product Overview : Recombinant human CSNK2A2 protein (Full Length), fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Full Length
Description : Casein kinase 2 subunit alpha, also known as CSNK2A2, regulates numerous cellular processes, such as cell cycle progression, apoptosis and transcription, as well as viral infection. This protein may act as a regulatory node which integrates and coordinates numerous signals leading to an appropriate cellular response.
Form : Liquid
Molecular Mass : 43.7 kDa (374aa) confirmed by MALDI-TOF
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSHMPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
Purity : > 85% by SDS-PAGE
Applications : SDS-PAGE
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by Bradford assay)
Storage Buffer : 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 30% glycerol, 1mM DTT
References : 1. Keller D.M., et al. (2001) Mol. Cell. 7:283-292
2. Sayed M., et al. (2001) Oncogene. 20:6994-7005
Gene Name CSNK2A2 casein kinase 2 alpha 2 [ Homo sapiens (human) ]
Official Symbol CSNK2A2
Synonyms CSNK2A2; casein kinase 2 alpha 2; CK2A2; CSNK2A1; CK2alpha'; casein kinase II subunit alpha'; CK II alpha'; casein kinase 2 alpha'; casein kinase 2, alpha prime polypeptide; EC 2.7.11.1
Gene ID 1459
mRNA Refseq NM_001896
Protein Refseq NP_001887
MIM 115442
UniProt ID P19784

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CSNK2A2 Products

Required fields are marked with *

My Review for All CSNK2A2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon