Recombinant Human CSF3 Protein
Cat.No. : | CSF3-490H |
Product Overview : | Recombinant human CSF3 protein |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Protein Length : | 207 |
Description : | This gene encodes a member of the IL-6 superfamily of cytokines. The encoded cytokine controls the production, differentiation, and function of granulocytes. Granulocytes are a type of white blood cell that are part of the innate immune response. A modified form of this protein is commonly administered to manage chemotherapy-induced neutropenia. Alternatively spliced transcript variants have been described for this gene. |
Form : | Lyophilized |
AA Sequence : | MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CSF3 colony stimulating factor 3 (granulocyte) [ Homo sapiens (human) ] |
Official Symbol | CSF3 |
Synonyms | CSF3; colony stimulating factor 3 (granulocyte); C17orf33, chromosome 17 open reading frame 33 , G CSF, GCSF; granulocyte colony-stimulating factor; filgrastim; granulocyte colony stimulating factor; lenograstim; MGC45931; pluripoietin; GCSF; CSF3OS; C17orf33; |
Gene ID | 1440 |
mRNA Refseq | NM_000759 |
Protein Refseq | NP_000750 |
MIM | 138970 |
UniProt ID | P09919 |
◆ Recombinant Proteins | ||
CSF3-134H | Active Recombinant Human CSF3 Protein | +Inquiry |
CSF3-1165M | Recombinant Mouse CSF3 protein(Met1-Ala208) | +Inquiry |
CSF3-1830H | Recombinant Human CSF3 Protein (Thr31-Pro207), N-His tagged | +Inquiry |
CSF3-775H | Recombinant Human CSF3 protein, His-tagged | +Inquiry |
CSF3-207H | Recombinant Human colony stimulating factor 3 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF3-2948HCL | Recombinant Human CSF3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSF3 Products
Required fields are marked with *
My Review for All CSF3 Products
Required fields are marked with *
0
Inquiry Basket