Recombinant Human CSF1, StrepII-tagged

• Cat.No.: CSF1-216H
• Product Overview: Purified, full-length human recombinant Macrophage colony-stimulating factor 1 or CSF1 protein (amino acids 33-191, 159 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 18.5 kDa. (Accession NP_000748.3; UniProt P09603)

Specification

• Description: CSF1 is a cytokine that plays an essential role in the regulation of survival, proliferation, and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.
• Source: Human Cells
• Species: Human
• Tag: StrepII
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• Protein length: 33-191, 159 a.a.
• AA Sequence: EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAI AIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQD VVTKPDCNC
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: CSF1 colony stimulating factor 1 (macrophage) [ Homo sapiens ]
• Official Symbol: CSF1
• Synonyms: CSF1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; M CSF; MCSF; MGC31930; lanimostim; CSF-1
• Gene ID: 1435
• mRNA Refseq: NM_000757
• Protein Refseq: NP_000748
• MIM: 120420
• UniProt ID: P09603
• Chromosome Location: 1p21-p13
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Integrins in angiogenesis, organism-specific biosystem; Osteoclast differentiation, organism-specific biosystem
• Function: cytokine activity; growth factor activity; growth factor activity; macrophage colony-stimulating factor receptor binding; macrophage colony-stimulating factor receptor binding; protein homodimerization activity