Recombinant Human CSF1, StrepII-tagged

Cat.No. : CSF1-216H
Product Overview : Purified, full-length human recombinant Macrophage colony-stimulating factor 1 or CSF1 protein (amino acids 33-191, 159 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 18.5 kDa. (Accession NP_000748.3; UniProt P09603)
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Strep II
Protein Length : 33-191, 159 a.a.
Description : CSF1 is a cytokine that plays an essential role in the regulation of survival, proliferation, and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
AA Sequence : EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAI AIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQD VVTKPDCNC
Endotoxin : <0.1 eu per ug protein by lal
Purity : >95% pure by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name CSF1 colony stimulating factor 1 (macrophage) [ Homo sapiens ]
Official Symbol CSF1
Synonyms CSF1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; M CSF; MCSF; MGC31930; lanimostim; CSF-1;
Gene ID 1435
mRNA Refseq NM_000757
Protein Refseq NP_000748
MIM 120420
UniProt ID P09603
Chromosome Location 1p21-p13
Pathway Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Integrins in angiogenesis, organism-specific biosystem; Osteoclast differentiation, organism-specific biosystem;
Function cytokine activity; growth factor activity; growth factor activity; macrophage colony-stimulating factor receptor binding; macrophage colony-stimulating factor receptor binding; protein homodimerization activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CSF1 Products

Required fields are marked with *

My Review for All CSF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon